VW Camper Kitchens
vwcamperkitchens.netUnlike other kitchen units these require no scribing whatsoever – all the hard work has been done already. All the contours of your transporter are programmed in.
VW Camper Kitchens is an e-commerce website that was registered on March 29, 2021. The store is hosted on the Shopify platform under the account name vwcamperkitchens.myshopify.com. The publicly registered domain name for this store is vwcamperkitchens.net.
The store collects payments in the GBP currency, and uses the English language setting for its website.
The store owner can be contacted via email at info@VWcamperkitchens.net
Note: This website, Merchant Genius, is not affiliated with VW Camper Kitchens. Please contact the store owner directly for any issues or questions pertaining to the online store.
The store collects payments in the GBP currency, and uses the English language setting for its website.
The store owner can be contacted via email at info@VWcamperkitchens.net
Note: This website, Merchant Genius, is not affiliated with VW Camper Kitchens. Please contact the store owner directly for any issues or questions pertaining to the online store.
Sponsored Content
Shop Preview
General Information on VW Camper Kitchens
This store is hosted on Shopify
The store was registered on March 29, 2021
The store language setting is English
The store currency setting is GBP
Contact Information for VW Camper Kitchens
vwcamperkitchens.netvwcamperkitchens.myshopify.com
info@VWcamperkitchens.net 
6004245
Sponsored Content
Products for Sale on VW Camper Kitchens
No product data found for this store
