sprinkledsweetnessacademy is an e-commerce website that was registered on October 8, 2021. The store is hosted on the Shopify platform under the account name sprinkledsweetnessacademy.myshopify.com. The publicly registered domain name for this store is sprinkledsweetnessacademy.com.
The store collects payments in the USD currency, and uses the English language setting for its website.
It does not appear that the store owner has provided a contact email address. We recommend visiting the website directly for further details. You can also check out our FAQ for additional information.
Note: This website, Merchant Genius, is not affiliated with sprinkledsweetnessacademy. Please contact the store owner directly for any issues or questions pertaining to the online store.
The store collects payments in the USD currency, and uses the English language setting for its website.
It does not appear that the store owner has provided a contact email address. We recommend visiting the website directly for further details. You can also check out our FAQ for additional information.
Note: This website, Merchant Genius, is not affiliated with sprinkledsweetnessacademy. Please contact the store owner directly for any issues or questions pertaining to the online store.
Sponsored Content
Shop Preview
General Information on sprinkledsweetnessacademy
Contact Information for sprinkledsweetnessacademy
Sponsored Content
Products for Sale on sprinkledsweetnessacademy
No product data found for this store