Self Care Isn’t Selfish Care Packages
selfcareisntselfishcarepackages.comSelf care packages promoting positive mental health and well-being and promoting self help techniques.
Self Care Isn’t Selfish Care Packages is an e-commerce website that was registered on August 31, 2022. The store is hosted on the Shopify platform under the account name selfcareisntselfishcarepackages.myshopify.com. The publicly registered domain name for this store is selfcareisntselfishcarepackages.com.
The store collects payments in the AUD currency, and uses the English language setting for its website.
The store owner can be contacted via email at selfcareisntselfishcarepackages@gmail.com
Note: This website, Merchant Genius, is not affiliated with Self Care Isn’t Selfish Care Packages. Please contact the store owner directly for any issues or questions pertaining to the online store.
The store collects payments in the AUD currency, and uses the English language setting for its website.
The store owner can be contacted via email at selfcareisntselfishcarepackages@gmail.com
Note: This website, Merchant Genius, is not affiliated with Self Care Isn’t Selfish Care Packages. Please contact the store owner directly for any issues or questions pertaining to the online store.
Sponsored Content
Shop Preview