
Payne Financial Services
paynefinancialservicesllc.comPayne Financial Services is a financial, accounting, and investment firm that specializes in tax preparation services and accounting/wealth management from the cradle to the grave. As part of our offerings we offer life insurance, annuities, tax preparation, general accounting and bookkeeping, and consulting.
Payne Financial Services is an e-commerce website that was registered on January 11, 2022. The store is hosted on the Shopify platform under the account name paynefinancialservicesllc.myshopify.com. The publicly registered domain name for this store is paynefinancialservicesllc.com.
The store collects payments in the USD currency, and uses the English language setting for its website.
It does not appear that the store owner has provided a contact email address. We recommend visiting the website directly for further details. You can also check out our FAQ for additional information.
Note: This website, Merchant Genius, is not affiliated with Payne Financial Services. Please contact the store owner directly for any issues or questions pertaining to the online store.
The store collects payments in the USD currency, and uses the English language setting for its website.
It does not appear that the store owner has provided a contact email address. We recommend visiting the website directly for further details. You can also check out our FAQ for additional information.
Note: This website, Merchant Genius, is not affiliated with Payne Financial Services. Please contact the store owner directly for any issues or questions pertaining to the online store.
Sponsored Content
Shop Preview